Mutations of the brpR and brpS genes affect biofilm formation in Staphylococcus aureus

Figure 5 Highlight of amino acid residues shared by competence stimulating pheromone, competence stimulating pheromone-2, and BrpS. The predicted exterior segment of BrpS, which spans N’-1-MKNLKNSLFISLIIGLSLSLFFSMLFADGKYYPLNPQSTIGILYYTHFT-50-C’, was compared to competence stimulating pheromone (CSP) and CSP-2 by BLASTp. The competence stimulating peptides of Streptococcus mutans (1-SGSLSTFFRLFNRSFTQA-18, CSP) and Streptococcus pneumoniae (1-EMRISRIILDFLFLRKK-17, CSP-2) has 56% similarity to CSP and 30% similarity to CSP-2. CSP: Competence stimulating pheromone.